Protein coding transcript 62646

• Transcript: Ll_transcript_286360
• CDS coordinates: 117-743 (+)
• Peptide sequence: MSQGDTIPLHPHLSSQSDIDEIENLMNASPATVLPARPPSPPRASIPVSSSPFIPSNLPPLPSKSSSSSSSSTQNHIPKPPSQPVPSRPDLAPTGFGSPPNTLTEPVWDTVKRDLSRIVSNLKLVVFPNPFREDPGKALRDWDLWGPFFFIVFLGLVLSWSASVKKVPSNFLLLFSFTSFFVMQWILSLLYQNFGFIFCYESKNDVLY*
• ORF Type: complete

Annotations of Ll_transcript_286360

• Blastp: Protein YIPF6 homolog from Dictyostelium with 40.7% of identity
• Blastx: Protein YIPF6 homolog from Dictyostelium with 44.78% of identity
• Eggnog: yip1 domain family member(COG5080)
• Kegg: Link to kegg annotations (DDB_G0282825)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463777.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;