Protein coding transcript 62653

• Transcript: Ll_transcript_285283
• CDS coordinates: 52-633 (+)
• Peptide sequence: MKFRYAMVCSSNQNRSMEAHFLLKKQGFDVSSYGTGAHVKLPGPSLREPNVYDFGTPYKHMLDDLRRKDPELYKRNGILPMLKRNSMVKLAPQRWQENAADGSFDVVFTFEEKVFDMVVEDLHNRNHVLMKTVLIINLEVKDNHEEAAVGARHTADLCQEIEAAESWEESIDDIVTGYEKQHRRKLLYTISFY*
• ORF Type: complete

Annotations of Ll_transcript_285283

• Blastp: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 from Dictyostelium with 50.78% of identity
• Blastx: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 from Gallus with 52.06% of identity
• Eggnog: RNA polymerase II subunit A C-terminal domain phosphatase(COG5211)
• Kegg: Link to kegg annotations (DDB_G0272871)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436756.1)
• Pfam: Ssu72-like protein (PF04722.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;