Transcript | Ll_transcript_286401 |
---|---|
CDS coordinates | 220-696 (+) |
Peptide sequence | MRKKIWIFWCLVFVECYLAIAREIVAQEKEETAIPVQTFSPPEGNTTFIDGTTWCVALAGVSQTDLQNALDWACGLGMTDCTAIKVGGPCYEPDTLVSHASFAFNTYYQANGNSDIACNFGGTATVTKNNPSKFRYKCYTVPSEVSLTRSSKHDFNIC* |
ORF Type | complete |
Blastp | Glucan endo-1,3-beta-glucosidase 13 from Arabidopsis with 55.7% of identity |
---|---|
Blastx | Glucan endo-1,3-beta-glucosidase 13 from Arabidopsis with 55.7% of identity |
Eggnog | glucan endo-1-3-beta-glucosidase(ENOG410YA1S) |
Kegg | Link to kegg annotations (AT5G56590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462833.1) |
Pfam | X8 domain (PF07983.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer