Protein coding transcript 62854

• Transcript: Ll_transcript_286401
• CDS coordinates: 220-696 (+)
• Peptide sequence: MRKKIWIFWCLVFVECYLAIAREIVAQEKEETAIPVQTFSPPEGNTTFIDGTTWCVALAGVSQTDLQNALDWACGLGMTDCTAIKVGGPCYEPDTLVSHASFAFNTYYQANGNSDIACNFGGTATVTKNNPSKFRYKCYTVPSEVSLTRSSKHDFNIC*
• ORF Type: complete

Annotations of Ll_transcript_286401

• Blastp: Glucan endo-1,3-beta-glucosidase 13 from Arabidopsis with 55.7% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 13 from Arabidopsis with 55.7% of identity
• Eggnog: glucan endo-1-3-beta-glucosidase(ENOG410YA1S)
• Kegg: Link to kegg annotations (AT5G56590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462833.1)
• Pfam: X8 domain (PF07983.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;