| Transcript | Ll_transcript_284500 |
|---|---|
| CDS coordinates | 1014-1550 (+) |
| Peptide sequence | MIDDLSCVEDQHNSFYFSSENTCSNTPRTSQEDIEASKFVPYYANSNDCLDIEYNRDETMHGQYSLEESILQNLEMAIAQFTGKTRICFRDALYRLARDTKQQHLVENLDGGLNMQEPMPHEVLTDTMRSEDKETMETDTNNVDRAVANLMYNKMETNMQDLPLTTSVNTNNQEVNGT* |
| ORF Type | complete |
| Blastp | Protein LNK3 from Arabidopsis with 38.39% of identity |
|---|---|
| Blastx | Protein LNK3 from Arabidopsis with 38.39% of identity |
| Eggnog | NA(ENOG410Z9PA) |
| Kegg | Link to kegg annotations (AT3G12320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413137.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer