Protein coding transcript 62898

• Transcript: Ll_transcript_284502
• CDS coordinates: 250-972 (+)
• Peptide sequence: MDCYYGCDINDFRVPEDRDLLDRHPSPQNWSGWGINAPEGFESPKKYFTADTNSTELEFDFMDEGFSHEIELGVSLHDKDQSTSSSAHGGLLELSFQQTEISSDQPNCKLQDLSCFEQTDDIFLDSMIDDLSCVEDQHNSFYFSSENTCSNTPRTSQEDIEASKFVPYYANSNDCLDIEYNRDETMHGQYSLEESILQNLEMAIAQFTGKTRICFRDALYRLARDTKQQHLVENLDGGLNM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_284502

• Blastp: Protein LNK4 from Arabidopsis with 26.51% of identity
• Blastx: Protein LNK4 from Arabidopsis with 27.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G06980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413137.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;