Protein coding transcript 62899

• Transcript: Ll_transcript_284484
• CDS coordinates: 293-1108 (+)
• Peptide sequence: MDSYYGCGIDDFRVPEDQDLLDRHPSPENWSEWGGNASEGFDSPKKYFTINTNSTLLEFDFMNESFDHESKLEYSLHDKDQSTSSSAFGGFFEQSSQQPTISSDQPNYELQDISCFEQTDDIFLDSMIDDLSCIENQHKAFYFYSENPCSNTHRGSQEDLEASKSVPYNSNSSDLDIESNRDETMHEQSSLEESILQNLEMAIAQFNGKTRICFRDALYRLAKDTKQQHLVENLDGGLNMQEPMPHEVLTDTMRYIIYICCMSVMFFWPFN*
• ORF Type: complete

Annotations of Ll_transcript_284484

• Blastp: Protein LNK4 from Arabidopsis with 28.99% of identity
• Blastx: Protein LNK4 from Arabidopsis with 28.99% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G06980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449992.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;