Transcript | Ll_transcript_286078 |
---|---|
CDS coordinates | 381-809 (+) |
Peptide sequence | MLLSKQKKNQNANARRLLISINVLGSAGPIRFVVKEEDLVAKVIDTALKSYAREGRLPVLGNDIASFALYCPHVGSDALSPWDAIGSHGARNFMLCRKPQPSTENVDDDAAADGNGIPLSRRGSGSWKAWLNKSLNLKISSH* |
ORF Type | complete |
Blastp | Uncharacterized protein At4g22758 from Arabidopsis with 35.71% of identity |
---|---|
Blastx | Uncharacterized protein At4g22758 from Arabidopsis with 36.73% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT4G22758) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446272.1) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer