Protein coding transcript 63021

• Transcript: Ll_transcript_286673
• CDS coordinates: 440-868 (+)
• Peptide sequence: MLVESLMMIIASIVPNYLMGIITGAGIQGLMILVGGFFKLPNELPKPVWRYPVHYVAFHSYAFQGLFKNEYEGLKFNAEKVGGGSHKYISGEEVLRTTWEVEMGHSKWVDLAILFGMIVLYRVIFLVILKTTEKVKFIQACK*
• ORF Type: complete

Annotations of Ll_transcript_286673

• Blastp: ABC transporter G family member 15 from Arabidopsis with 46.85% of identity
• Blastx: ABC transporter G family member 11 from Arabidopsis with 52.53% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT3G21090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420525.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;