Protein coding transcript 63033

• Transcript: Ll_transcript_286666
• CDS coordinates: 1-336 (+)
• Peptide sequence: GTMAKAIAKSFPQLDCIVFDLPHVVTGLQGSDNLKYVGGNMFEAIPPTDAILLKWILHDWNDEECVNILKKCKEAITSKGKNEGKVIIIDMVISENEKRGGESIETQLFFDM
• ORF Type: internal

Annotations of Ll_transcript_286666

• Blastp: Trans-resveratrol di-O-methyltransferase from Vitis with 67.86% of identity
• Blastx: Trans-resveratrol di-O-methyltransferase from Vitis with 67.86% of identity
• Eggnog: o-methyltransferase(ENOG410XS7T)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432228.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;