Transcript | Ll_transcript_284434 |
---|---|
CDS coordinates | 294-818 (+) |
Peptide sequence | MLRVVHNVQNVLYKESSASVRLHLQESVDYRISHVVFSLVPRQSHGKQQCLGGTKLELTMKIRPTSCTTSIRAAAEYRDLPDDDDVCPVECVREFTTDEEFCRILDKAKNTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGDHDAPVIFLKHNVSMVFVVFSSVISHKILVIS* |
ORF Type | complete |
Blastp | Thioredoxin-like 4, chloroplastic from Arabidopsis with 72.97% of identity |
---|---|
Blastx | Thioredoxin-like 4, chloroplastic from Oryza sativa with 73.33% of identity |
Eggnog | CCR4-NOT transcription complex subunit 2(COG5601) |
Kegg | Link to kegg annotations (AT1G07700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437959.1) |
Pfam | Thioredoxin (PF00085.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer