Protein coding transcript 63173

• Transcript: Ll_transcript_284434
• CDS coordinates: 294-818 (+)
• Peptide sequence: MLRVVHNVQNVLYKESSASVRLHLQESVDYRISHVVFSLVPRQSHGKQQCLGGTKLELTMKIRPTSCTTSIRAAAEYRDLPDDDDVCPVECVREFTTDEEFCRILDKAKNTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGDHDAPVIFLKHNVSMVFVVFSSVISHKILVIS*
• ORF Type: complete

Annotations of Ll_transcript_284434

• Blastp: Thioredoxin-like 4, chloroplastic from Arabidopsis with 72.97% of identity
• Blastx: Thioredoxin-like 4, chloroplastic from Oryza sativa with 73.33% of identity
• Eggnog: CCR4-NOT transcription complex subunit 2(COG5601)
• Kegg: Link to kegg annotations (AT1G07700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437959.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;