Transcript | Ll_transcript_285807 |
---|---|
CDS coordinates | 190-573 (+) |
Peptide sequence | MMGDQLSGLSVRNLQDLENQLEVSLQGVRMKKEQILTDEIRELNQKGNLIHQENVELYKKANLIQQENTQLCKKVYGTTDVAVRRNVFVPIPFDVDAGRDQQALIQLQLSQPDQETCETSGSGSSTK* |
ORF Type | complete |
Blastp | Agamous-like MADS-box protein AGL17 from Arabidopsis with 48.78% of identity |
---|---|
Blastx | MADS-box transcription factor 27 from Oryza sativa with 57.14% of identity |
Eggnog | Transcription factor(COG5068) |
Kegg | Link to kegg annotations (AT2G22630) |
CantataDB | Link to cantataDB annotations (CNT0002701) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422741.1) |
Pfam | K-box region (PF01486.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer