Protein coding transcript 63256

• Transcript: Ll_transcript_285811
• CDS coordinates: 208-609 (+)
• Peptide sequence: MQIKRQMMGDQLSGLSVRNLQDLENQLEVSLQGVRMKKEQILTDEIRELNQKGNLIHQENVELYKKANLIQQENTQLCKKVYGTTDVAVRRNVFVPIPFDVDAGRDQQALIQLQLSQPDQETCETSGSGSSTK*
• ORF Type: complete

Annotations of Ll_transcript_285811

• Blastp: Agamous-like MADS-box protein AGL17 from Arabidopsis with 49.6% of identity
• Blastx: MADS-box transcription factor 27 from Oryza sativa with 52.41% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G22630)
• CantataDB: Link to cantataDB annotations (CNT0002701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422741.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;