Protein coding transcript 63257

• Transcript: Ll_transcript_285812
• CDS coordinates: 78-458 (+)
• Peptide sequence: MGEQLYGLSVRNLQDLENQLEMSLQGVRMKKEQNLTEEIQELNRKGNLIHQENVELYKKVNIIQQENMQLCKKVYGITDMAASKNIFVPLPFDVRAGQDPQALIELQLCQPDQETCETSGSGSATK*
• ORF Type: complete

Annotations of Ll_transcript_285812

• Blastp: Agamous-like MADS-box protein AGL16 from Arabidopsis with 54.24% of identity
• Blastx: Agamous-like MADS-box protein AGL16 from Arabidopsis with 54.92% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT3G57230)
• CantataDB: Link to cantataDB annotations (CNT0002701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420953.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;