Protein coding transcript 63258

• Transcript: Ll_transcript_285816
• CDS coordinates: 703-1239 (+)
• Peptide sequence: MTSMKSVVERYNTCKEENQQLINPESEVKFWQKEAGILRQQLQNLQENHRQMMGDQLSGLSVRNLQDLENQLEVSLQGVRMKKEQILTDEIRELNQKGNLIHQENVELYKKANLIQQENTQLCKKVYGTTDVAVRRNVFVPIPFDVDAGRDQQALIQLQLSQPDQETCETSGSGSSTK*
• ORF Type: complete

Annotations of Ll_transcript_285816

• Blastp: Agamous-like MADS-box protein AGL21 from Arabidopsis with 56.47% of identity
• Blastx: Agamous-like MADS-box protein AGL21 from Arabidopsis with 57.14% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT4G37940)
• CantataDB: Link to cantataDB annotations (CNT0002701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422741.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;