Protein coding transcript 6326

• Transcript: Ll_transcript_495484
• CDS coordinates: 644-1222 (+)
• Peptide sequence: MLDYQTGRSRGFGFVTFDSEDSVEKVVSAGIIHELGGKQVEIKRAEPKRSGVDYSSTSRKSYGGFGNEMNGFGGHNPRGQNIGKRGGPYTDSGMNGAYSHFDGSYSGKSATAHGGYCGYGYGFGYGGPMYCFGGYGVNSYVNPGGYGAIATYGDGNSYGRVGSFNGTCGYDNGKVAEKDENPANGRYHPYWK*
• ORF Type: complete

Annotations of Ll_transcript_495484

• Blastp: Heterogeneous nuclear ribonucleoprotein 27C from Sophophora with 45.83% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 42.66% of identity
• Eggnog: Rna-binding protein(ENOG410YA8Z)
• Kegg: Link to kegg annotations (Dmel_CG10377)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436500.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;