Transcript | Ll_transcript_340505 |
---|---|
CDS coordinates | 2-307 (+) |
Peptide sequence | NAGFGSDKLMLVEGGVQQSWIWKVKEDGMTSTAASAGMLMQWDVEMGLDKIDAFTYVNEDQVKAGAALATGIINSGVRLDGDPAMALLGDLEGKSVAVKVAS |
ORF Type | internal |
Blastp | 26S proteasome regulatory subunit rpn-1 from Neurospora with 56.19% of identity |
---|---|
Blastx | 26S proteasome regulatory subunit rpn-1 from Neurospora with 56.19% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU07721) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453693.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer