Protein coding transcript 63363

• Transcript: Ll_transcript_284663
• CDS coordinates: 1-639 (+)
• Peptide sequence: SAFSFSIFHFYYPHLATNKWRNPMWSSPILSHSIYLPFSFFYLYKGFMVFFSITFFHFPEPIMEGNWAEGKRTLEYDDEEDEEDEVISEIMSNGDEGRNKKRAVTKDLYRSKRGSKAGGSVAPSCQVDSCKTDLSDAKQYHRRHKVCEYHAKAPFVLIADHQQRFCQQCSRLRNPNLLCFFSFSTSYSICIFVLVFEVQDLKLLPEIEFAIC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_284663

• Blastp: Squamosa promoter-binding protein 1 from Antirrhinum with 45.95% of identity
• Blastx: Squamosa promoter-binding protein 1 from Antirrhinum with 44.04% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418278.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;