Protein coding transcript 63377

• Transcript: Ll_transcript_286655
• CDS coordinates: 337-1050 (+)
• Peptide sequence: MTEQKRPPRSTTRGFYVKMKILHKHGRPQQEKSSCCFYTYYKWLLWLSLSLYFFTSYLITNNNNNLKSTKLSPLDSTNSNTTKNPLTTNLKFQQQSSSLLNNLKVFVYDLPPKYNTNWLENERCSTHLFASEVAIHRALLTSKVRTFDPYEADFFFVPVYVSCNFSAVNGFPAIGHARSLIASAVKLISKEYPFWNRSRGSDHVFVASHDFGSCFHTLVRCWNNFTLKRSTYVTFID*
• ORF Type: complete

Annotations of Ll_transcript_286655

• Blastp: Probable glucuronoxylan glucuronosyltransferase IRX7 from Arabidopsis with 52.61% of identity
• Blastx: Probable glucuronoxylan glucuronosyltransferase IRX7 from Arabidopsis with 67.97% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT2G28110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448752.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;