Transcript | Ll_transcript_285757 |
---|---|
CDS coordinates | 1694-2617 (+) |
Peptide sequence | MSNFCMYELEDNMWDEFCETGDHIVPHAGDEHKDQFAIQGNTDSCEKSLQELQGIKRCSDCVSNYGTQGKEDLYLENLNPKERMLEKISSWPHKPEGLFSSCDGDSCKELNRLTSDNTKMFDHCFKGSNVDSSSSELRADDTIMGNKCVVEDDSVSQYSINHISQTDNELSFLDNDVWLDIGNFEDVDRTMSCDLTFGMESFDNEEGFSSWLSSSHGTEGPDDALKSGFNFASAEMCPLKTMSDYNITLKENIEGLPINDCNKKASLIDEKLRSQMDVDHDAVPAPPSTFSESDMISGNTDAMMPKEK |
ORF Type | 3prime_partial |
Blastp | Protein LNK1 from Arabidopsis with 33.04% of identity |
---|---|
Blastx | Protein LNK1 from Arabidopsis with 33.04% of identity |
Eggnog | NA(ENOG410YS2X) |
Kegg | Link to kegg annotations (AT5G64170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426322.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer