Protein coding transcript 63492

• Transcript: Ll_transcript_284702
• CDS coordinates: 3-563 (+)
• Peptide sequence: CLKRGRRYSIYPFRFLLLLIVKFRALETFHCYKRFNFVVEKVVKGKVEMQTEARVGVAVDGGVRKLVQPQKKQVGTVSQLLAGGVAGALSKTCTAPLARLTILFQIQGMHSNVATLRKASMWNEASRIIHEEGFRAFWKGNLVTIAHRLPYSSVNFYSYEHYKKVSGITTRDIFISVKLSYRESCI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_284702

• Blastp: Calcium-binding mitochondrial carrier protein SCaMC-1 from Homo with 37.62% of identity
• Blastx: Mitochondrial substrate carrier family protein B from Dictyostelium with 50% of identity
• Eggnog: Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P)
• Kegg: Link to kegg annotations (29957)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006595883.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;