Protein coding transcript 6351

• Transcript: Ll_transcript_495331
• CDS coordinates: 190-621 (+)
• Peptide sequence: MIICVAVVGHQNNPLFIQSFTEADDALKLHHIVHCSLDVVDERVNNPKKSGPMLNETFLGLLYPFENYKVYGYLTNTKVKFILVTTDLDVRDADVRNFFRRFHAAYVDAVSNPFHVPGKKITSKTFVERVSTIVKSFGLSSAG*
• ORF Type: complete

Annotations of Ll_transcript_495331

• Blastp: Trafficking protein particle complex subunit 2-like protein from Dictyostelium with 48.57% of identity
• Blastx: Trafficking protein particle complex subunit 2-like protein from Dictyostelium with 48.57% of identity
• Eggnog: trafficking protein particle complex(ENOG4111IEZ)
• Kegg: Link to kegg annotations (DDB_G0292690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452710.1)
• Pfam: Sedlin, N-terminal conserved region (PF04628.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;