Protein coding transcript 63516

• Transcript: Ll_transcript_286550
• CDS coordinates: 160-471 (+)
• Peptide sequence: MGKNQKVGLGRSLVKQHNHMIQQTKEKGRIYKKKFLESFTEVTDIAAIIEKSENPDADSDSDADVPFLPPAPPTLRINMYFFSFCIAFNTCIFCHTHFFLFSI*
• ORF Type: complete

Annotations of Ll_transcript_286550

• Blastp: GTPase LSG1-1 from Arabidopsis with 58.9% of identity
• Blastx: GTPase LSG1-1 from Arabidopsis with 69.64% of identity
• Eggnog: Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity (By similarity)(COG1161)
• Kegg: Link to kegg annotations (AT2G27200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448890.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;