Protein coding transcript 63600

• Transcript: Ll_transcript_284868
• CDS coordinates: 3-605 (+)
• Peptide sequence: PYIQYLQVLTLIFSLLLIIFLGVNLKTQFACTFTFCSPLNNSSSLKEYLYSVYTSAAQYNRPPQYPVTVICGGIDGASSKSDILSKINAGLVAYKGDKTCKVNGPTNVSETNMGWKWQRCSEFVLPIGIGNNSMFEPNPFSLELYTNECKKHFGVSPRPHWITTYYGGYVSVSFFYTYPYISIVFIFIWFSILFSSVTFY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_284868

• Blastp: Lysosomal Pro-X carboxypeptidase from Mus with 33.77% of identity
• Blastx: Lysosomal Pro-X carboxypeptidase from Mus with 31.43% of identity
• Eggnog: Lysosomal Pro-X(ENOG410Y38A)
• Kegg: Link to kegg annotations (72461)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436307.1)
• Pfam: Serine carboxypeptidase S28 (PF05577.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;