Protein coding transcript 63606

• Transcript: Ll_transcript_285504
• CDS coordinates: 1-954 (+)
• Peptide sequence: KPAPPKPPPPTQRVPLTQLLKVASVAGGIQFGWALQLSLLTPYVQQLGIPHAWASIIWLCGPLSGLFIQPLVGLLSDRCTSRFGRRRPFILGGAVFIIFSVLVIGHAADVGWWFGDTADHRPWAVAVFVFGFWILDVANNVTQGPCRALLGDLTGKDHRRTRVANAYFSLFMAIGNILGYATGAYSGWYKVFPFTLTSACNISCANLKSAFFLDIVLIAVTTYISIISAHEVPLNSNGAAHDGETAGESGSTEEAFMWELLGTFRYFSTPVWTILSVTALTWVGWFPFLLFDTDWMGREIYGGEPNEGLNYDSGVRIG
• ORF Type: internal

Annotations of Ll_transcript_285504

• Blastp: Sucrose transport protein SUC4 from Arabidopsis with 69.52% of identity
• Blastx: Sucrose transport protein SUC4 from Arabidopsis with 69.58% of identity
• Eggnog: solute carrier family 45 member(ENOG410XPTR)
• Kegg: Link to kegg annotations (AT1G09960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438462.1)
• Pfam: MFS/sugar transport protein (PF13347.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;