Protein coding transcript 63654

• Transcript: Ll_transcript_285871
• CDS coordinates: 247-1800 (+)
• Peptide sequence: MGLSGGIPDSLKYCGKSLQSLNFGSNSLTSEIPSEMCNWMPFLVSLDLSGNKLSGNIPPTIDQCFYLNVLMLENNDLSGSIPSEFDDLIRLKKFSVANNRLSGAIPALFDDFDKGGFDGNVGLCGGPLGSKCGGLSKKNLAIIVAAGVFGAVACLLLGFGFWWWYHLRLRWRRKRGCRVGDNDGGGGGDENWAASLRGFKFVQVSLFQQPIVKVKLRDLMAATNNFSDESVLISTRMGTTYKAILRDGSMLAVKRLDTCKIGKKQFRMEMNRLGQVRHPNLAPLLGFCVVEEEKLLVYKHMPNGTLYSMLHNNGGGLDWLMRFRIGLGIARGLAWLHHGCRPPIIHRNICSNVILVDDDFDARLMDFGLDRHIKLDYNDSFVNRDLGELGYIAPEYPSTLVASLKGDVYGFGVLLLELVTGRKPIDVSNGKEEFWGNLVDWVNMHSSSGRIKDCFDKAISESGHDEEILQFLNVALNCVVSRPNDRWSMSRVYHSLKGISEDHSFSEHDDEFPLIFG*
• ORF Type: complete

Annotations of Ll_transcript_285871

• Blastp: Inactive LRR receptor-like serine/threonine-protein kinase BIR2 from Arabidopsis with 60.83% of identity
• Blastx: Inactive LRR receptor-like serine/threonine-protein kinase BIR2 from Arabidopsis with 59.97% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G28450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428228.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;