Transcript | Ll_transcript_436416 |
---|---|
CDS coordinates | 45-500 (+) |
Peptide sequence | MGQGLSCRANHNEHGLFTAVQHGDLQTVATLLQADPSLLHHTTVYDRHSPLHIAAANGQIQILSRLLHGSVNPDVLNRQKQTPLMLAAMHGKIDCVEKLLEAGANVRFHYLVLVFDAIYGRTCLHYAAYYGHACCLKAILSSAQYSPVAASW |
ORF Type | 3prime_partial |
Blastp | Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 61.18% of identity |
---|---|
Blastx | Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 61.18% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT2G28840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458241.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer