Protein coding transcript 63679

• Transcript: Ll_transcript_436429
• CDS coordinates: 288-974 (+)
• Peptide sequence: MGQSLSCRGSHEHGLFRAVQHGDLETFATLLETCPSLMHHTTVYDRHSPLHIAAANGQIQILTRLLNGSVNPDVLNRQKQTPLMLAAMHGKIACVEKLLEAGANVLMFDSVYGRTSLHYAAYYGHSSCLKAILSTAQSSPVAASWGFARFVNIRDGRGATPLHLAARQRRPECVHILLDSGALVCAPTGRYGCPGSTALHLAARGGSLDCIRPLLAWGADRLQRDTSG*
• ORF Type: complete

Annotations of Ll_transcript_436429

• Blastp: Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 71.05% of identity
• Blastx: Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 71.05% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G28840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413933.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;