Protein coding transcript 63692

• Transcript: Ll_transcript_436422
• CDS coordinates: 45-419 (+)
• Peptide sequence: MGQGLSCRANHNEHGLFTAVQHGDLQTVATLLQADPSLLHHTTVYDRHSPLHIAAANGQIQILSRLLHGSVNPDVLNRQKQVTLTSIPIFLLFIFFFFCINVLIVLHCIILNASDSAYVGSNAR*
• ORF Type: complete

Annotations of Ll_transcript_436422

• Blastp: Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 57.14% of identity
• Blastx: Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 82.25% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT2G28840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013465385.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;