Transcript | Ll_transcript_340517 |
---|---|
CDS coordinates | 48-701 (+) |
Peptide sequence | MSSLAPYSLWTSLQPKKATNYSSPKSSNLVSCNYNHHKTLSTSHSLVLLQNDETNPLSQLRRRDALTLSLSLGLLHAFFYPQQTLAAVEEVPCQLTVAPSGLAFCDKVLGTGSQAVKGQLIKAHYVGRLENGKVFDSSYNRGKPLTFRVGIGEVIKGWDEGILGGDGVPPMLAGGKRTLKLPPELAYGSRGAGCKGGSCVIPPDSVLLFDVEFVSKA* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic from Arabidopsis with 57.01% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic from Arabidopsis with 78.03% of identity |
Eggnog | Peptidyl-prolyl cis-trans isomerase(COG0545) |
Kegg | Link to kegg annotations (AT5G45680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462527.1) |
Pfam | FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer