Protein coding transcript 63721

• Transcript: Ll_transcript_437826
• CDS coordinates: 1-378 (+)
• Peptide sequence: HKRDNPSWVAIQKIAARDGKIGLHNFAPIRPLGCGDTGSVHLVELQGTGELYAMKAMEKSVMLNRNKVHRACIEREIISLLDHPFLPTLYTSFQVCFFLSALISPYNPETSGSCECILYFKCLCP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_437826

• Blastp: Phototropin-2 from Oryza sativa with 78.95% of identity
• Blastx: Phototropin-2 from Arabidopsis with 63.3% of identity
• Eggnog: Histidine kinase(COG2202)
• Kegg: Link to kegg annotations (4335426)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424315.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;