Protein coding transcript 63727

• Transcript: Ll_transcript_437813
• CDS coordinates: 449-868 (+)
• Peptide sequence: MKIFNEESARFYAAEVVIGLEYLHCLGIIYRDLKPENILLQKDGHVVLTDFDLSFMTSSKPQVVKHPLPSKRRKSGSQPPPTFVAEPVSQSNSFVGTEEYIAPEIITGAGHTSAIDWWTFGILLYEMLYGRTPFRGKNRQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_437813

• Blastp: Phototropin-2 from Arabidopsis with 83.57% of identity
• Blastx: Phototropin-2 from Arabidopsis with 85.42% of identity
• Eggnog: Histidine kinase(COG2202)
• Kegg: Link to kegg annotations (AT5G58140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446969.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;