Protein coding transcript 63729

• Transcript: Ll_transcript_437815
• CDS coordinates: 449-763 (+)
• Peptide sequence: MKIFNEESARFYAAEVVIGLEYLHCLGIIYRDLKPENILLQKDGHVVLTDFDLSFMTSSKPQVVKHPLPSKRRKSGSQPPPTFVAEPVSQSNSFVGTEEYIAPV*
• ORF Type: complete

Annotations of Ll_transcript_437815

• Blastp: Phototropin-2 from Arabidopsis with 79.61% of identity
• Blastx: Phototropin-2 from Arabidopsis with 83.23% of identity
• Eggnog: Histidine kinase(COG2202)
• Kegg: Link to kegg annotations (AT5G58140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446969.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;