Transcript | Ll_transcript_437818 |
---|---|
CDS coordinates | 1-378 (+) |
Peptide sequence | HKRDNPSWVAIQKIAARDGKIGLHNFAPIRPLGCGDTGSVHLVELQGTGELYAMKAMEKSVMLNRNKVHRACIEREIISLLDHPFLPTLYTSFQVCFFLSALISPYNPETSGSCECILYFKCLCP* |
ORF Type | 5prime_partial |
Blastp | Phototropin-2 from Oryza sativa with 78.95% of identity |
---|---|
Blastx | Phototropin-2 from Oryza sativa with 78.95% of identity |
Eggnog | Histidine kinase(COG2202) |
Kegg | Link to kegg annotations (4335426) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424317.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer