Protein coding transcript 63736

• Transcript: Ll_transcript_436295
• CDS coordinates: 1142-1453 (+)
• Peptide sequence: MLLITISINKIIEKYRQCCFNMSQTGDLVEHQSSQNLYEEVLKLRAKHESLEKTQRIFEGEDLGPLSMKELQSLEKQIDRTLSQARQHHVHIPINIITTLYFD*
• ORF Type: complete

Annotations of Ll_transcript_436295

• Blastp: MADS-box transcription factor 17 from Oryza sativa with 46.59% of identity
• Blastx: MADS-box transcription factor 17 from Oryza sativa with 43.75% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442168.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;