Protein coding transcript 63742

• Transcript: Ll_transcript_436292
• CDS coordinates: 136-807 (+)
• Peptide sequence: MGRGRVIVERIENKISRQVTFSKRRSGLLKKAFELSVLCDAEIALIIFSSRGKLFQFSTSDINKIIEKYRQCCFNMSQTGDLVEHQSSQNLYEEVLKLRAKHESLEKTQRIFEGEDLGPLSMKELQSLEKQIDRTLSQARQHHMQKLTARIDELRQQVQNLEGVNKQLEAKETDKLTHTIGEVSNNSTTSVCSYNDIRLHDVQPKHFESGTALQTWCALYYNF*
• ORF Type: complete

Annotations of Ll_transcript_436292

• Blastp: MADS-box transcription factor 17 from Oryza sativa with 57.31% of identity
• Blastx: Probable fructokinase-7 from Arabidopsis with 72.96% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442167.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;