Protein coding transcript 63757

• Transcript: Ll_transcript_436325
• CDS coordinates: 40-441 (+)
• Peptide sequence: MASFTSMSSAGSLAAPPHNLSSSASISAFPFAAGRRQNSNTVVLVRKNRNTRVSAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_436325

• Blastp: RuBisCO large subunit-binding protein subunit beta, chloroplastic from Pisum with 84.38% of identity
• Blastx: RuBisCO large subunit-binding protein subunit beta, chloroplastic from Pisum with 84.38% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425621.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;