Protein coding transcript 63763

• Transcript: Ll_transcript_437133
• CDS coordinates: 173-1018 (+)
• Peptide sequence: MTFGGCATAELSRFVAGSSTRNKPSQCTINSTSHRFLQLQRPIDENRLVLSVSRDRVVAKAAEGGRGLTYKDAGVDIDAGSELVRRIAKMAPGIGGFGGLFPLGDSFLVAGTDGVGTKVMLAFETGIHDTIGIDLVAMSVNDIVTSGAKPLFFLDYFATGHLDVNIAEKVIKGIVNGCQQSDCVLLGEETAEMPGLYKDGEYDLSGCAVGIVKKDSVINGKNIVPGDVLIGLPSSGVHSNGFSLVRRVLAQSGLSLKDKLPGGDVTIAEALMAPTVIYVKQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_437133

• Blastp: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 77.74% of identity
• Blastx: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 77.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414494.1)
• Pfam: AIR synthase related protein, N-terminal domain (PF00586.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;