Protein coding transcript 63764

• Transcript: Ll_transcript_437134
• CDS coordinates: 316-804 (+)
• Peptide sequence: MLAFETGIHDTIGIDLVAMSVNDIVTSGAKPLFFLDYFATGHLDVDIAEQVIKGIVDGCQQSDCVLLGGETAEMPGLYKEGEYDLSGCAVGIVKKDSVINGKNIVPGDVLIGLPSSGVHSNGFSLVRRVLAQSGLSLKDKLPGGDVTIAEALMAPTVIYVKQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_437134

• Blastp: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 92.64% of identity
• Blastx: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 90.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417681.1)
• Pfam: AIR synthase related protein, N-terminal domain (PF00586.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;