Transcript | Ll_transcript_437412 |
---|---|
CDS coordinates | 1735-2073 (+) |
Peptide sequence | MNGKEVFRFAVRYVPQSIESALQKAGLPASSIDWLLLHQANQRIIDAVATRLEVPSERVISNLANYGNTSAASIPLALDEAVRSGKVKAGQIIAAAGFGAGLTWGSAIIRWG* |
ORF Type | complete |
Blastp | 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic from Arabidopsis with 57.39% of identity |
---|---|
Blastx | 3-oxoacyl-[acyl-carrier-protein] synthase 3 B, chloroplastic from Cuphea with 84.96% of identity |
Eggnog | Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched- chain and or straight-chain of fatty acids (By similarity)(COG0332) |
Kegg | Link to kegg annotations (AT1G62640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436161.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer