Protein coding transcript 63955

• Transcript: Ll_transcript_436768
• CDS coordinates: 2501-2893 (+)
• Peptide sequence: MGFTTHIITVAIGEDIAEKIISFSQQSPKGTAICILTANGAVSTVTVRQPSTAGGTAIYEGNFQIASLKGSYLPTDSGASQSGGLSILFSCPDGGAIGGVIGGVLIAASEVQVIIGSFEYGGSKAKRKKI*
• ORF Type: complete

Annotations of Ll_transcript_436768

• Blastp: AT-hook motif nuclear-localized protein 1 from Arabidopsis with 52.24% of identity
• Blastx: AT-hook motif nuclear-localized protein 1 from Arabidopsis with 52.21% of identity
• Eggnog: AT hook motif domain containing protein, expressed(ENOG410YFD3)
• Kegg: Link to kegg annotations (AT4G12080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460602.1)
• Pfam: Domain of unknown function (DUF296) (PF03479.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;