Protein coding transcript 63973

• Transcript: Ll_transcript_437946
• CDS coordinates: 2586-3041 (+)
• Peptide sequence: MNPDPSGRVQYDDFLQVLRLQDCPLSEKVFAFIDVENRGAITFRQFLYASAHVMTQPDFNQACEVAFAERGGAVKAYIDEQELQDFIRHAIPGWKEDGVHKLFELFDNDNDGRINKDDFLSCLRRNPLLIALFTPHLQHKEYGCNGVIEIV*
• ORF Type: complete

Annotations of Ll_transcript_437946

• Blastp: Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 52.55% of identity
• Blastx: Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 57.2% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT2G45670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456944.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;