Protein coding transcript 63980

• Transcript: Ll_transcript_437944
• CDS coordinates: 81-431 (+)
• Peptide sequence: MSFSRCPFFLRFLCFQVIYVDRSSPSSRKQVVQEIKRRASYDKFPRVLLFPEGTTTNGRNLISFQLGAFIAGYPIQPVIVRYPHVHFDQSWGSVSLTMLMFRMLTQFHNFFEVEYLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_437944

• Blastp: Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 77.88% of identity
• Blastx: Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 63.83% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT2G45670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426294.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;