Transcript | Ll_transcript_437944 |
---|---|
CDS coordinates | 81-431 (+) |
Peptide sequence | MSFSRCPFFLRFLCFQVIYVDRSSPSSRKQVVQEIKRRASYDKFPRVLLFPEGTTTNGRNLISFQLGAFIAGYPIQPVIVRYPHVHFDQSWGSVSLTMLMFRMLTQFHNFFEVEYLP |
ORF Type | 3prime_partial |
Blastp | Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 77.88% of identity |
---|---|
Blastx | Lysophospholipid acyltransferase LPEAT2 from Arabidopsis with 63.83% of identity |
Eggnog | Acyltransferase(COG0204) |
Kegg | Link to kegg annotations (AT2G45670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426294.1) |
Pfam | Acyltransferase (PF01553.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer