Protein coding transcript 64032

• Transcript: Ll_transcript_437762
• CDS coordinates: 1-1152 (+)
• Peptide sequence: QKQFLHFITKRSKMCGGAIISDFISAGGAPAKSRILTADYLWPDLKKSGSEKSKKKKVLIDLDDDFEADFRDFNEESEVDDDDDDVFMMDSKKKPCALKSAKSYTSISHVFEAQQQADKSVKRKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFRTAEEAARAYDAEARRIRGRKAKVNFPDEALDASPKCSKANPQGKMNTVQPNGNLSQKFNVVGSNQDNFYTSMDLVEQKPMVIQYANMGSFPRRGHENNSLASSDDLTRYFSSDQGSNSFDYSDLPEISSMLSAPLEGESHFMQYANQQQNIPHSNSQDASAKSLSDELAEIESELNFFKMPYFEGSWSDASFESLLAGDTTQYGGNLMNLWSFDDINMGGGGVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_437762

• Blastp: Ethylene-responsive transcription factor RAP2-12 from Arabidopsis with 41.67% of identity
• Blastx: Ethylene-responsive transcription factor RAP2-2 from Arabidopsis with 43.34% of identity
• Eggnog: Transcription factor(ENOG410YERP)
• Kegg: Link to kegg annotations (AT1G53910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423543.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;