Protein coding transcript 64034

• Transcript: Ll_transcript_437766
• CDS coordinates: 1306-1848 (+)
• Peptide sequence: MNTVQPNGNLSQKFNVVGSNQDNFYTSMDLVEQKPMVIQYANMGSFPRRGHENNSLASSDDLTRYFSSDQGSNSFDYSDLPEISSMLSAPLEGESHFMQYANQQQNIPHSNSQDASAKSLSDELAEIESELNFFKMPYFEGSWSDASFESLLAGDTTQYGGNLMNLWSFDDINMGGGGVL*
• ORF Type: complete

Annotations of Ll_transcript_437766

• Blastp: Ethylene-responsive transcription factor RAP2-2 from Arabidopsis with 31.52% of identity
• Blastx: Ethylene-responsive transcription factor RAP2-2 from Arabidopsis with 43.28% of identity
• Eggnog: Transcription factor(ENOG410YERP)
• Kegg: Link to kegg annotations (AT3G14230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423543.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;