Protein coding transcript 64050

• Transcript: Ll_transcript_437774
• CDS coordinates: 155-994 (+)
• Peptide sequence: MYGEWILVPLNFLKFNFLSSGGDYYGTHKWHWYFAQGFTVMIFSHLPFCIAGIIYSKQWKFAGVIAWVLGFYSILGHKEFRFVLPVLPIALMFSGYSLAVIEDPGSPVYRGKKASEKNTKCSPKMTVAILFLLATNIPMALYMSLVHQRGPEDVMNHLAGEAQHGKVKSILFLTPCHATPYYSMLHHNLPMQFLDCTPSEEKGVPDESDNFMMDPVLFVSEYAKKWSLPSHIVLFDSEEQKLRNSLTSFGYREERRFFNAHFKVDRDLQASIVVYVLVK*
• ORF Type: complete

Annotations of Ll_transcript_437774

• Blastp: GPI mannosyltransferase 3 from Mus with 40.43% of identity
• Blastx: GPI mannosyltransferase 3 from Mus with 39.31% of identity
• Eggnog: phosphatidylinositol glycan anchor biosynthesis, class B(ENOG410XYK9)
• Kegg: Link to kegg annotations (55981)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453898.1)
• Pfam: Alg9-like mannosyltransferase family (PF03901.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;