Protein coding transcript 64157

• Transcript: Ll_transcript_436465
• CDS coordinates: 3-368 (+)
• Peptide sequence: CYLTWERYAENNYEFNVFKCLQFRLLHLTLSSQVRHGSSSSRLKDSSINKSVKHEDKSDIHDFGVMLQELILGRTIKSRKDVDAFKDLVRTWTLLHFMWHFLFPMLSLNLQISNVNRFPLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_436465

• Blastp: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 52.63% of identity
• Blastx: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 75% of identity
• Eggnog: inactive leucine-rich repeat receptor-like protein kinase(ENOG410XPGM)
• Kegg: Link to kegg annotations (AT3G03770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458654.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;