Protein coding transcript 64163

• Transcript: Ll_transcript_436473
• CDS coordinates: 873-2408 (+)
• Peptide sequence: MLTAFSLEKVLILGIFLQYNQNPLTMSNRGHSSLLLLLVTIILSFHYSEELQSSQSQNLLRIQRLLNFPAALSTWNKNTDFCSTDSNSSLTVVCYEGNITQLNIIGERRTPLKNFSINSFVTTLIRLQSLKVLTLVSLGIYGSLPGNIANLSSLEIVNVSSNFIYGSIPQEISSLSNLQTLILDNNMFAGQLPSWFVSIPALTVLSLKNNLFNGLLPSSVSSLVSLRILSLSNNHFNGAVPDLSSLKNLQVLELDDNAFGPQFPRLSNKLVALVLRNNRFRSGIPAELSSHYQLEKLDISSNTFVGPFQPALLSLPSITYLNISKNKLTGMLFENISCNSDIDVVDISSNLLTGSLPRCLVPNSGNSVRSVLYARNCLEKPNRNQQPPAFCRTGAFAVGILPDRKKHTQVSKVVLSIGIVGGTLGGVALVLLIFFIIRRKNVKSKMKNHPTRLISENAASGYTSKLLSDASNSLFLNLFLMQVTLFLNLFLMHDLTTLYSFMYFSIHMQSI*
• ORF Type: complete

Annotations of Ll_transcript_436473

• Blastp: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 59.85% of identity
• Blastx: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 from Arabidopsis with 67.62% of identity
• Eggnog: inactive leucine-rich repeat receptor-like protein kinase(ENOG410XPGM)
• Kegg: Link to kegg annotations (AT3G03770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422316.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;