Protein coding transcript 64220

• Transcript: Ll_transcript_437469
• CDS coordinates: 217-525 (+)
• Peptide sequence: MKLSYTPTSSLSMFPFSTTQPYTTHIILVLILILVPRIAVIPNPIHPDHQRSQINLISNHEIHQYIFTIHHGINDSSHLSHFRSTFASVLIQIGSVEDHEFR*
• ORF Type: complete

Annotations of Ll_transcript_437469

• Blastp: Glycosyltransferase family protein 64 C3 from Arabidopsis with 66.83% of identity
• Blastx: Glycosyltransferase family protein 64 C3 from Arabidopsis with 66.34% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT1G80290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438810.1)
• Pfam: Glycosyl transferase family 64 domain (PF09258.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;