Protein coding transcript 64226

• Transcript: Ll_transcript_437486
• CDS coordinates: 621-1181 (+)
• Peptide sequence: MVEVLSSAIIILFVSFTSTLQINHINISPLPSLFLLKVSRSIGDVYMKQAQFNREPLAAKFRLPEPMNMPYMTANPTILSHSLQPNDSFLIFASDGLWEHLSNEKAVDIVNSNPHAGSAKRLIKAALHEAARKREMRYSDLRKIDKKVRRHFHDDISVIVLFLNHDLISRGTVLSSPLSIRSALDH*
• ORF Type: complete

Annotations of Ll_transcript_437486

• Blastp: Probable protein phosphatase 2C 42 from Arabidopsis with 75.48% of identity
• Blastx: Probable protein phosphatase 2C 42 from Arabidopsis with 75.48% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT3G17090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419589.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;