Protein coding transcript 643

• Transcript: Ll_transcript_452616
• CDS coordinates: 196-708 (+)
• Peptide sequence: MASPTLLTPTSTPTKSLPPLNPKTTTISATLTPPTTTPRRRVFLSMTASTTTCFFLLPLTPALAASDEEYVKETEEVINKVRTTITLDKNDPNVAGAVAELRDTSNSWVAKYRREKNLLGRASFRDMYSALNAVSGHYISFGPTDPIPAKRKARILEEVTTAEKALQRGR*
• ORF Type: complete

Annotations of Ll_transcript_452616

• Blastp: Photosystem II repair protein PSB27-H1, chloroplastic from Arabidopsis with 61.24% of identity
• Blastx: Photosystem II repair protein PSB27-H1, chloroplastic from Arabidopsis with 66.42% of identity
• Eggnog: Photosystem II(ENOG4111SBP)
• Kegg: Link to kegg annotations (AT1G03600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437370.1)
• Pfam: Photosystem II Pbs27 (PF13326.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;